GenomeNet

>aje:HCAG_02616 K11427 histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43] | (RefSeq) hypothetical protein (A)
MGFFDHLQTKGSIAIQPKRPQIRRVETATKPAQPTTSRAAPVASECSGPKPAPHSHQRRN
RNPNPPTSSRRSSSSARASSTASDPTPSRHHDPAPRLKARSLTRKRPSLIQRLTSSSDES
DTEASFLEIRKRMKVSTSAEPDLQRQVRSTVAFAEDAGKQTIPIVHASDIASMDKPAEFS
RAFGDGSGSVSVEPFMVRLQYPGISQGENYQLVIPREKEGFKPLDDIVHVVSIVSQHYIP
EEHVHLFNDETTGINRRFRRALAHASESEFTAVVEEYNKIINRLRTDGIIAKHLDNIHSL
PLPLVERILTQTYSRTVSPRVESLRQYENGTDNVYGELLPRFISDIFKQTKLKSDQVFVD
LGSGVGNVVLQAALEIGCESWGCEVMQNACDVAELQGREFEARCRLWGLSPGIVRLIRGS
FLTEESIIRALHRADVVLINNQAFTPQLNNEIINHFLDMKEGCQIVSLKSFVPAGHRIQA
RNLNSPVNLLSVKQKNYWSGSFEA

BLAST