GenomeNet

>aje:HCAG_02627 hypothetical protein; K10777 DNA ligase 4 [EC:6.5.1.1] (A)
MDSDGEGEPNGSRQQDSTANDLDEKYPNPPRNHSPTLPFHDLFLTLFNPLNENKKRPTGP
AAARRKVGPHGQGAAVHLSPQERRRDIIQRFISRWRKEVGDDIFPAFRLIIPEKDRDRAM
YGLKEKAIGKLLVKVMKIDKNSEDGFSLLNWKVPGQSFASRMAGDFAGRCFEVISKRPLR
TEVGDMTIDEVNEQLDKLSAASKEDEQVPILAYFYRRMNPEELMWLIRIILRQMKVGATE
RTFFSIWHPDAEALFSISSSLRRVCWQLYNTDVRLEGDETKVTLMQCFQPQLAQFQMQSF
EHMIRRMRLTEDDPTFWIEEKLDGERIQLHMKPDDSIPGGKRFGFWSRKAKEYTYLYGNG
LLDENGALTRHLQDAFADGVQSIILDGEMITWDPEHDAIVPFGTLKTAALAEQRNPFSTG
QRPLFRIFDILYLNGRPLTRYTLKDRRKALEASVIPVHRRFEIHTYDIGHSATDIDPLLR
KVVAEASEGLVLKNPNSPYRLNERHDDWMKVKPEYMTDFGESLDCIVIGGYYGSGRRGGA
LSSFLCGLRVDGSHSKTGDHPTKCYSFCKVGGGFTAADYANIRHHTDGKWMDWDPKRPPT
EYIELAGGDLQYERPDVWIKPEDSVVLCVKASSVTSTDQFRLGLTVRFPRFKRLRMDKDW
RSALSIQEFMDLKSNVEREVKEKEFKVDDSRKVRHRKAIKKPLTIAGYDGGKKLEYVGPS
GTLFDGLNFFIMTESVHQPKKTKAQLEQLVKANGGKIYQTNNVAENTICIADRTDQEEEI
AEHVDKYSDSYARDIDASELKKLLDSMHPAPALPPSSLSELESQLESHSLNERKPATPTI
SNTSTCPGWLFKGLVIYFAMPPSLSNEGNGKIPHVLPQRLYLASNLVKFAGGEVITDDDG
DMKDARITHVVVDSNPPGDKAAMAAADVAGIRRAISSRAGVGKRIPHIVGVEWVEESWGE
RTLVDEERFTPK

BLAST