GenomeNet

>aje:HCAG_06585 K01580 glutamate decarboxylase [EC:4.1.1.15] | (RefSeq) similar to glutamate decarboxylase isoform 3 GAD3 (A)
MSSNDPTAATGNQCLERSEEVRNLLSAVQERIVAFIQSADQYDFSSAKIEHASARSSALV
QSMRPEELQAALNLEIPLSGQGQNGFLRILDQVLEYSVNTWHQGFLDKLYSSTNAPGIAA
ELIIASLNTNVHVYPVSPALTVIEKYTSKQVASLFGLDGPKAGGISVQGGSASNATSIVV
ARNTLFPKTKKDGCDGYKFVLFTSAHGHYSIEKAAQSLGFGSSAIWSVPVDQKGRMIPQS
LESLVVKAKNEGRTPFYVNATAGTTVLGSFDPLEQIAFICRKHNLWFHVDASWGGSYAFS
RRQRAKIAGSHLADSITVNPHKMLGVPVTCSFLLGADMNKFHRANTLPAAYLFHNDYLAA
DLNGNADVSVPEVWDLADMTLQCGRRADSLKFFLSWTYYGTEGYERQIDAASDMAAYFVA
AVSDCPNLLLISENPPPCLQVCFCYAPNKQLIFRRDQEIEGKRIDEEERGKRNSKITEEV
VQKLVHCGFMVDFAPPVEDDPSAGDGKFLRLLGHVSVLKEQNHSAWEILESVDMGQLFVI
ELEILGYLPHFYARKNVHVQSICIYRWTMDTEQAFANWLKLYNYATIFFS

BLAST