GenomeNet

>aje:HCAG_08002 K11484 histone deacetylase HOS3 [EC:3.5.1.98] | (RefSeq) hypothetical protein (A)
MSHGLTHAAIIDFDLHHGDGSQDIAWEQNRKASAASRNSPSHKKTAIGYFSLHDINSYPC
EAGDVNKVRNASVCIDNAHGQSVWNIHLEPWKTSAGFWELYNTKYSILLEKARNFLRYHT
QRLINSQNPSLPKAAIFISAGFDASEWEGVGMQRHKVNVPTDFYAKFTADIVQIAEDEAL
GVDGRVISVLEGGYSDRALISGVLSHLSGLADSQRTGFENGDNRLATEMISRLGLNDCPE
TVLEEDSTFDTEWWTLPMLETLELLANPPPPTPARKSREKGPPTYCSPTQASAAKIVLPS
RDRRSISSQLSAGDSGYPRLPLPVVDWATAAYEMSKVLIPTNRQTVSLQHSELKGENTRT
KRDRHSTSNVSELNAADDRKPMQLRERKPKPPSPEHLTTKQPSKASRRATIASVSDIPDA
SATEPPESCNQNPKPVDSHSSRRLSVASTVASTGGARSRGSVEETSPPSSNGSSARRIDS
RRGTSNGKSGEPLTVKKLGGVRTSPRKPSAARQARPIGGGPIPPVRSSSINTDTSERDLT
NLSAVPSPEEHAAREEERRKIATSRSASRKSQTSKASRSSSTTATGKVSNPDTALAQSPP
PPPVAGTTLSTRFDPIKQEMAHLPHKNSDIEGIPIPDLSSFPHSANSYSEVVRGWPSDPT
TKRTHIEPSKNPSPATKKLSIVLARKLRRNEIH

BLAST