GenomeNet

>aje:HCAG_08002 hypothetical protein; K11484 histone deacetylase HOS3 [EC:3.5.1.98] (A)
MSHGLTHAAIIDFDLHHGDGSQDIAWEQNRKASAASRNSPSHKKTAIGYFSLHDINSYPC
EAGDVNKVRNASVCIDNAHGQSVWNIHLEPWKTSAGFWELYNTKYSILLEKARNFLRYHT
QRLINSQNPSLPKAAIFISAGFDASEWEGVGMQRHKVNVPTDFYAKFTADIVQIAEDEAL
GVDGRVISVLEGGYSDRALISGVLSHLSGLADSQRTGFENGDNRLATEMISRLGLNDCPE
TVLEEDSTFDTEWWTLPMLETLELLANPPPPTPARKSREKGPPTYCSPTQASAAKIVLPS
RDRRSISSQLSAGDSGYPRLPLPVVDWATAAYEMSKVLIPTNRQTVSLQHSELKGENTRT
KRDRHSTSNVSELNAADDRKPMQLRERKPKPPSPEHLTTKQPSKASRRATIASVSDIPDA
SATEPPESCNQNPKPVDSHSSRRLSVASTVASTGGARSRGSVEETSPPSSNGSSARRIDS
RRGTSNGKSGEPLTVKKLGGVRTSPRKPSAARQARPIGGGPIPPVRSSSINTDTSERDLT
NLSAVPSPEEHAAREEERRKIATSRSASRKSQTSKASRSSSTTATGKVSNPDTALAQSPP
PPPVAGTTLSTRFDPIKQEMAHLPHKNSDIEGIPIPDLSSFPHSANSYSEVVRGWPSDPT
TKRTHIEPSKNPSPATKKLSIVLARKLRRNEIH

BLAST