GenomeNet

>aje:HCAG_08145 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) hypothetical protein (A)
MAGTIARVNRRMRAFFRNIMTLLKRMMTFPSQLGESSDSRQDSLSNSSKRRRRTLDDLSQ
EVERLFTGHLNVSNLLSMSNKIRAQIDICAKTSPVCMLPSFNHTLPTGKESGTYLAMDLG
GSTFRVALVELSGGGKMRIVRMVSSIIDETVKLLEGKAFFAWMAEKIEEMLSRGEEKYGM
DSMPLPIGLSWSFPIDQTSIRSGRVIAMGKGFRCSNGTVGDDLSELITEACRERNLNVRI
DAIVNDSSSTLLSRAYEDSSTRVSLILGTGTNAAIHYPVHAIGIDKFGTRPAEWFAQADH
VIVNTELSMFGGGGVLPTTRWDDILNQTHLRPDYQPLEYMCTGRYLGEIVRLIIVEAVKK
GGLFGGSLPESLRSPYTFDTSIAAHIQDDTSPSLTSSSAYLQKHHSFVTAPSLVDLQFLQ
QICTFVTRRAAAYLAASIHALWCLRNSSEAATLPPTPDSVISSSSPNDNSHGNDNPELSN
DLNKNPTNNTAATAATATTATTTTTTATATTTNTTIAPTIDYSTQNVTIACDGSVINKYP
GFYDQCQQYLNDLTLERDPSWHSRPISPPPESGATSPSQKVMTSVVASPSITLEKANESA
LFGAAVAVAVAVSEQ

BLAST