GenomeNet

>aje:HCAG_08145 hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MAGTIARVNRRMRAFFRNIMTLLKRMMTFPSQLGESSDSRQDSLSNSSKRRRRTLDDLSQ
EVERLFTGHLNVSNLLSMSNKIRAQIDICAKTSPVCMLPSFNHTLPTGKESGTYLAMDLG
GSTFRVALVELSGGGKMRIVRMVSSIIDETVKLLEGKAFFAWMAEKIEEMLSRGEEKYGM
DSMPLPIGLSWSFPIDQTSIRSGRVIAMGKGFRCSNGTVGDDLSELITEACRERNLNVRI
DAIVNDSSSTLLSRAYEDSSTRVSLILGTGTNAAIHYPVHAIGIDKFGTRPAEWFAQADH
VIVNTELSMFGGGGVLPTTRWDDILNQTHLRPDYQPLEYMCTGRYLGEIVRLIIVEAVKK
GGLFGGSLPESLRSPYTFDTSIAAHIQDDTSPSLTSSSAYLQKHHSFVTAPSLVDLQFLQ
QICTFVTRRAAAYLAASIHALWCLRNSSEAATLPPTPDSVISSSSPNDNSHGNDNPELSN
DLNKNPTNNTAATAATATTATTTTTTATATTTNTTIAPTIDYSTQNVTIACDGSVINKYP
GFYDQCQQYLNDLTLERDPSWHSRPISPPPESGATSPSQKVMTSVVASPSITLEKANESA
LFGAAVAVAVAVSEQ

BLAST