GenomeNet

>ajs:Ajs_2523 ATP-dependent DNA ligase LigD phosphoesterase module / ATP-dependent DNA ligase LigD polymerase module (EC:6.5.1.1); K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MPRKDPLAVYKQKRNFAVTPEPADGGAQSQALQYVIQKHWASRLHYDLRLELDGTMKSWA
VPKGPSYDPADKRMAVQVEDHPISYNQFEGQIPPRQYGAGRVIIWDRGYWVPQGNPREDY
RKGKLKFEIHGHKLHGHWTLVRMHGRDDDKQPPWLLIKECDGLERAAEEFNVVDEMPDSV
ADQPPVAPPARAFAQRAGPAQIQPTAAAVPWTSAPTAPLPDQLSPQLATLVDGPPADLTQ
WLWELKFDGYRMLARVQRGKARLYTRNGNDWTARMPALAQALAALPLSSAWIDGEVLVLD
AQGVPDFQALQNAFDGRSTDALVFYAFDLPYAHGRDLRQMPLAERRALLRSVLQPASSDR
VRFSEAFEARPADLVASACRLGFEGVIGKRKDSVYASRRSTDWIKLKCSHRQEFVIGGYT
DPQGSRTGIGSLLLGVHDEGGALRYAGNVGTGFSERVLADLARRLGALRTQDSPFAQPRS
IPRKVHWVRPTLVAEVSFAEWTKEGKVRHAVFRGLRDDKPAAAIVHEEPAHLQGAAPSRA
ARVGGLQVTSPARVVDPSTGFTKLDLVRYYATVAPLMLPHLQGRPVSLLRAPQGLEGELF
FQKHLDTGALDGVSALSPDLDPGHPPLLEVATAQGLLSAAQMNTVEFHTWNARKDRIERP
NRITFDLDPGEGVPWAHVQEGAALVRLMLTELGLPSFLKTSGGKGLHVVVPIKRLHGWDA
VKDFSQAVVQHLARTLPQRFVAKSGPRNRVGKIFVDYLRNGFGATTACAWTARARPGMGV
SVPVAWQELDALTGGAHWTVQTVDRRLKTGNGPWSGYDEAAVSIGPAIKALGEKRHT

BLAST