GenomeNet

>aka:TKWG_19270 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (GenBank) ATP-dependent DNA ligase (A)
MSLADYQRKRRFDRTPEPQEDAIGGGRPIFVVQLHHASHRHYDFRLQVAGVLKSWAVPKG
PSLDPSVKRLAVQVEDHPVSYARFEGDIPKGEYGGGHVRIFDSGIWSTNEEVEAQLAKGH
LKFELFGDILQGGWHLIRSHRRSRQQQWLLIKQDDAFAGDKEADDFVDESAALVTDGKGP
AAKKASAGKKTAAQKRAKDRAAKNITSKGTTSKAVADTKSQKNPATAAWRAQLDAFKGAK
RQPLQHKPFAPQLCLTADKAPVGDDWLHEVKWDGYRLLCTIVDGTPALWSRNGLDWTARL
PDVASDMASLGLQQAAFDGELVVLEGVHSNFSALQATLSGEKQAPLSYLLFDLIHLQGFD
LCDVPLQERKALLETVLQGAPSRLRYSSHLVGSGPQVFARVTAEKLEGIISKRVNASYHA
GRSRSWQKIKMELSDEFAIAGFIEPKGSRMGIGSLLLALPEGKSGWRLAGRVGTGMNDAM
LRQLSTLLRPVAETDPTVTVAGIDSDLRRAKWVKPRHVVEVFYRGHSSQGLLRHTAFKTL
REDKSVADLRGSQAKEEPMKKDTVQISSPDRLVYPEMQVSKQDVADYYERVMDWLLPGVA
GRPLSVLRCPDGTQKACFFQKHHTAGMDVSTVSLQEEQGGRQDYLMVRDKTDVMQLVQFN
SLEFHPWGALADSPDDCDRLVFDLDPSEQVSWATVKKAARQVRDLLEQLQLQSFVRTTGG
KGLHVVAPLKPPVPWEDARQFARAFAESLAGAHPDTYIATASKKQRKGLIFVDYLRNGRG
ATSVCSYSLRARPGAAVATPLRWEELGRVKSSDAFHIRNLPQRLARLASDPWEEMTAIRQ
SLPDLPE

BLAST