GenomeNet

>ali:AZOLI_p10724 cbbL; Ribulose bisphosphate carboxylase large chain (RuBisCO large subunit); K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MNYVSTTLPTDQKAADGVVSDPKARYRPGVLKYRQMGYWEPDYQPKDTDVLAVFRITPQD
GVDPEEAAAAVAGESSTATWTVVWTDRLTDCERYRAKAFRVDPVPGAPGQYFAYIAYELD
LFEEGSIANLTASIIGNVFGFKPLKGLRLEDMRIPVAYLKTFQGPATGIVVERERLNNFG
RPLLGATMKPKLGLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRDRFLYCMEGVN
RAIAETGEIKGTYLNVTAATMEDMYERAEFAKELGSVIVMIDLVIGYTAIQSMAKWARRN
DMILHLHRAGHSTYTRQKSHGVSFRVIAKWMRMAGVDHIHAGTVVGKLEGDPNVIRGIYD
TCRETHVPQNLQHGIFFDQPWAGLKRVMPVASGGIHAGQMHQLLTYLGEDVILQFGGGTI
GHPDGIQAGATANRVALEVMVKARNEGRDIWNEGPEILRDAARWCAPLRAALDTWKDVTF
DYASTDSVDYVPTPTAAM

BLAST