GenomeNet

>aly:ARALYDRAFT_333621 hypothetical protein; K00799 glutathione S-transferase [EC:2.5.1.18] (A)
MGVNASEVRITCYHHCNQTFESQELAHKDEYKIYGYPYSTNTRRVLAVLHEKGLSYDPIT
VDLKAGDQKKPRFLSINPFGQVPVFLDGDLKLTESRAISEYIVTVHKSRGTQLLNYESYK
KMGTQRMWMAIESFEFDPLTSILTLEQSIKPMYGLKTDYKVVNETEAKLEKVLDIYEERL
KKSSFLASNSFTMADLYHLPNIQYLMDTHTKRLFENRPSVRRWVAEIIARPAWKRACDVK
AWYHKKKN

BLAST