GenomeNet

>aly:ARALYDRAFT_474175 hypothetical protein; K00844 hexokinase [EC:2.7.1.1] (A)
MGKVAVAFAAVAVVAACSVAAVMVGRRMKSRRKWRTVVEILKELEDDCDTPVGRLRQVVD
AMAVEMHAGLASEGGSKLKMLLTFVDDLPTGREKGTYYALHLGGTYFRILRVHLGGQRSY
LDVQDVERHPIPSHLMNSTSEVLFNFLAFSLERFIEKEGNGSNSQGVRRELAFTFSFPVK
HTSISSGVLIKWTKGFEISEMVGQDIAECLQGALNRRGLDMHVGALVNDTVGALSLGYYH
DPDTVVAVVFGTGSNACYLERTDAIIKCQGLLTTSGSMVVNMEWGNFWSSHLPRTSYDID
LDAESSNANDMGFEKMISGMYLGDIVRRVILRMSQESDIFGPISPVLSEPYVLRTNSVSA
MHEDDTPELQEVARILKDLGVSDLPVKVRKLVVKICDVVTRRAGRLAAAGIAGILKKIGR
DGSGGITSGRSRSEIQMQKRTVVAVEGGLYMNYTMFREYMEEALVEILGDEVSQYVVVKA
MEDGSSIGSALLVASLQS

BLAST