GenomeNet

>aly:ARALYDRAFT_490831 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) hypothetical protein (A)
MTRKEVVLAVTAATVTAVAAVVLMGRWIRRKERRRKHTQRILRKFARECATPVSKLWAVA
DALVADMTASLAAATAECCGSLNMLVSFAGSLPSGDEKGVHYGVNLRGRELLLLRGTLGG
NEEPISDVHKQEIPIPEDVLNGSFKELCDFISLELVKFLAMNPGEEAEEVNNLGFTLTRS
VEQIGSGSISAIHRKSLANDDDDKVLKDLVNDMNESLERHGLKIRMNTALVDNTIGELAG
GRYYHKDTVAAVSLGLGTNAAYIEQAQEISRWKSAIFEPQEIVVSTEWGDFRSCHLPITE
FDASLDAESLNPGHRVFEKMVSGRYLGEIVRRVLLRMSEESALFGDTLPPKLTIPYILWS
PDMAAMHQDISEEREIVNKKLKEVFGIMDSTLAAREVVIEVCDVVAERAARTAGAGIVGM
IKKLGRLEKKMSIVIVEGGLYDHYRVFRNYLHSSVWEMLGDELSDHVVIEHSHGGSAAGA
LFLAACGDGGQQESESQ

BLAST