GenomeNet

>aly:ARALYDRAFT_493917 SDH2-2; succinate dehydrogenase 2-2; K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MTFGLIGRVVGTKSSRLYTAARLIPARWTSTGSEAQSKASTGGGGASLKTFQIYRWNPDN
PGKPELQDYQIDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGLA
CLTKIESGSKETTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKNPASVPGKEILQS
KKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLEA
IDDEFKLYRCHTILNCARACPKGLNPGKQITHIKQLQKSG

BLAST