GenomeNet

>aly:ARALYDRAFT_493921 hypothetical protein; K00006 glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8] (A)
MSPALEKSRQGNGECNEVSKSKVTVVGSGNWGSVAAKLIASNALKLPSFHDEVRMWVFEE
VLPNGEKLTDVINKTNENVKYLPGVKLGRNVVADPDLENAVKEANMLVFVTPHQFMDGIC
KKLDGKITGDVEAISLVKGMEVKKEGPCMISSLISKQLGINCCVLMGANIANEIAVEKFS
EATVGYRGSREIADTWVQLFSTPYFMVTPVHDVEGVELCGTLKNVVAIAAGFVDGLEMGN
NTKAAIMRIGLREMKALSKLLFPSVKDSTFFESCGVADVITTCLGGRNRRVAEAFAKSGG
KRSFDELEAEMLQGQKLQGVSTAREVYEVLNHCGWLEMFPLFSTVHQICTGHLQPEAIVQ
YRENKL

BLAST