GenomeNet

>aly:ARALYDRAFT_895166 K11420 euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43] | (RefSeq) hypothetical protein (A)
MEGVPGVNTVPNPNHYDKSIVLDVKPLRSLKPVFPNGNQGPPFVGCPPFGPSSSGSSPFF
PFGTQQPTQDTPDLNQTQDTPTPSFVPPLRSYRTPTETNGPSSSSGSKRGVGRPKGPSSV
KKKEKKTVANEPNLDVQVVKRFSSDFDSGISPAEREDGNAYLVSSVLMRYDAVRRRLSQV
EFAKAATSKAAGTLMSNGVRTNMKKRVGTVPGIEVGDIFFSRIEMCLVGLHMQTMAGIDY
ITSKAGSDEEPLATSIVASGRYEGEAQDPESLIYSGQGGNADKNGQASDQKLERGNLALE
KSLRKGNGVRVIRGEEDAATKTGKIYIYDGLYSISESWVEKGKSGCNTFKYKLVRLPGQP
PAFGVWKSVQKWKEGLTTRPGLILPDITSGAESKPVSLVNDVDEEKGPAYFTYISSLKYS
DSFKLTQPAIGCSCSGSCAPGNLNCSCIRKNDGDLPYLNGVMLVSRRPIIYECGPTCPCH
ASCKNKVIQTGLKSRLEVFKTGNRGWGLRSWDSIRAGSFICEYAGEVKDKGNLRGNQEED
EYVFDTSRVFNSFKWNYEPELVDEDPSDEVPEEFNLPSPLLISAKKFGNVARFMNHSCSP
NVFWQPVICEGNGESVIHIAFFAMRHIPPMAELTYDYGVSPTSEARDGSLLHGQRTCLCG
SEQCRGSFG

BLAST