GenomeNet

>aly:ARALYDRAFT_904976 SDH2-1; succinate dehydrogenase 2-1; K00235 succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (A)
MASGLIGRLVGTKPSKLATAARLIPARWTSTGAEAETKASSGGGRGSNLKTFQIYRWNPD
NPGKPELKDYQVDLKDCGPMVLDALIKIKNEMDPSLTFRRSCREGICGSCAMNIDGCNGL
ACLTKIEDGSSGTTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTPASVPAKEILQ
SKKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLE
AVDDEFKLYRCHTILNCARACPKGLNPGKQIAHIKQLQR

BLAST