GenomeNet

>aly:ARALYDRAFT_910314 K00857 thymidine kinase [EC:2.7.1.21] | (RefSeq) hypothetical protein (A)
MFGVSMRTLISPSLAPFSLHLPKPSLFSTALRFSSLTTSTISINNRSPTNAPPSAISTRK
LQTKATAPLSFTTPGEIHVVVGPMFSGKTTTLLRRILAEKETGKQIAIIKSNKDTRYCTE
SIVTHDGEKFPCWSLPDLSSFKERFGFDEYENRLDVIGIDEAQFFGDLYEFCRQAADREG
KTVIVAGLDGDFKRRRFGSVLDLIPIADTVTKLTSRCEVCGKRALFTMRKTEEKETELIG
GAEVYMPVCRSHYVCGQSVLETARAVLDSSSNKHDVVASLL

BLAST