GenomeNet

>aly:ARALYDRAFT_913590 phosphofructokinase family protein; K00850 6-phosphofructokinase 1 [EC:2.7.1.11] (A)
MSSSVSNSDRKIVTGPAGYILEDVPHFTDDFPDHPTYPNPLQDNAAYSVVKQYFVDEDDT
VPQKIVVHPDSPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSY
MYGVKRILGIDGGYRGFYARNTIHLDLKTVNDIHRTGGTILGTSRGGHDTTKIVDSIQDR
GINQVYIIGGDGSQKGAAAIFKEIRKRGLKVAVAGIPKTIDNDIPIIDKSFGFDTAVEEA
QRAINAAHVEATSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGPGGL
FEFIDKRLKESGHMVIVIAEGAGQDLLAESMEESTTLKDASGNKLLQDIGLWISQRIKDH
FAKKMTLTLKYIDPTYMIRAIPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTY
IPFYRITEKQNKVVITDRMWARLLSSTNQPSFMKQDKIHSNQLVGEPGTMKW

BLAST