GenomeNet

>amd:AMED_3255 K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] | (RefSeq) lig; ATP-dependent DNA ligase (A)
MAADDASLVPAWLEPMLAKADGGRLRTGPEWAYEYKLDGYRAAMRIAPDGTTVLTSRNNI
DFTAEFTDLEGVLAPALDGRAAYLDGEIVVYGEDGRIDFERMQERRGRYVRHQSGPKGRE
FTDVPVRFLAFDLLRLGDESLLAMPYDERRRLLAELPMPDPYRVSVVRAVTFDELAADRR
TPADFLAHAASAGYEGVVAKLRSSAYHPGQRPDSWLKHPLVRTQEVIVCGWRPGQNSFTG
TLGGLLLGAHDPATGDLVYIGDVGTGFSQATRADLRAQLEAMERRTHPFVTTPPREDTAR
ARWVEPRLVGEIVYRQFTRGGRVRHTAWRGLRHDKDPAEVLAPRAVPHEPAGAAPAPPSP
SSSASASASPSPEPAGQRITVQAGDRRLTLSNLDKVLYPADGFTKGEVINYYSRVAAVLL
PHLAGRPVTFIRYPNGVDGQKWFEKNAPKGAPDWLRTVRLAGTGGTIDYPLLDDLPGLVW
AANMAALELHVPQWTVEQGTRQPPDRLVFDLDPGPGTTIVDCCRVAERLHDVLVADGLTP
YAKTSGSKGMQLYCGIRTDDPAAPSAYAKRLAQRLAKETPESVTAVMAKAQRTGRVFIDW
SQNNPAKTTVAPYSLRGRDHPTASTPVTWDEVRACRHVNRLTFTADDVLDRLEDHGDLLA
GLIEDRAPLG

BLAST