GenomeNet

>amd:AMED_5275 lig; ATP-dependent DNA ligase; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MADKLEEYRGKRARDRTSEPWPDGPPAPGDNDLFVIQEHHATRLHWDFRLERDGVLVSWA
VPKGLPLSPGVPRLAVHTEDHPMEYLTFSGEIPAGEYGGGRMTVWDTGKYETLHWNDHKV
EVVFHGERARGKYLFTNRHDEDDRDWTLRRLDPAEPGHEDAPEFVEPMTAVPGELPADDD
EWAYEFAWGGLRTMLLVCGGRVTAHDETGADVTARYPELHKLGEQLGSTEVLLDGEVVVV
KDGKPDPDGLDERRRADGAAAKRLKASCPVFYFASDVLHLEGRATLELPYTKRRELLDGL
PIEDRHWQVPRYYLGGGEAVAGASRQHGLPGVVAKRADSPYQPGGGPGDWLLIRN

BLAST