GenomeNet

>ame:408536 angiotensin-converting enzyme; K01283 peptidyl-dipeptidase A [EC:3.4.15.1] (A)
MKISMTPSWILLFPSLFSLVHGQLDIPSLNENSRGNFGRRLPPTEGELQDILARLDFLGT
ERCSANVAAQWSYETDVNEYTQIQALEAQRIYADFQNQAWFLISRIDKNNIRDPVIGRRL
RYLSVVGPSALPPDQLDRYNRVINDMLAVYNEATICAYNDPFRCGLRLYPDISQIMAKSR
NWDELQYVWTEWRRRSGMRIKDLYQQLVTLNNEAAKLNNFTDAAEYWMFPYESPNLQQDI
DEVWEMIRPLYEELHAYIRRKLRDLYGPEKIGSHSLLPAHILGNIWAQSWTNIIDITIPY
PGKNNLDVTQEMQAQGYTPIEMFRIAEEFYLSLNLSAMPPEFWAGSIIVDPGDRSLICQA
SAWDFCNRLDYRIKMCTKVTMKDLITVHHEMAHIEYFLRYSGLTREFRDGANPGFHEAVG
EAVALSVATPRHLQTLSLGNKYIDEFTTDINYLFTLAMDKLVMLPFSIVMDRWRWDVFRG
YVTREDYNCHWHRLMEQYAGIKPPVLRSEDDFDPGAKYHIPANIPYIRNFVAGVLQFQLY
RALCQAAGQRSVDDFRRPLHRCDFYRSPEAGRILGKIMERGSSVPWQETLQEAIGEDRLD
ATALREYFRPLEDWLRTENLRTGDVVGWSYDGDYCKRSIETAGLQVYGSGFYNGAVSITT
TKATLPAIFSILFTILTLC

BLAST