GenomeNet

>ame:408752 GB20092; DNA ligase 1-like protein; K10747 DNA ligase 1 [EC:6.5.1.1] (A)
MFSRIILNASLNLFKNNYLYMIYINEHFKLCNISFSIVNNIVNCTHANSIKVNSKDRNNP
RNGKRKRNNSEDTDTISPSPIKKSENSLKQKSTPKIKLISNETSIQNEKKKAKTPTSSKK
KKKIEELAKTPKKTNTKKILKDTINLKEKKENELIVESKIESSPEFKSSESLLEDYDNKI
NLKNAKEKVNKKKSRSIEEDKIESSSEIESSKSSSEKSNSKKNLKKTEKKVIKKRSRIIA
PVDDSSDEEECIPLPESPKKINLNEKEKNPVSEEEKSNKNVIDNTKNNKKEKEENVEITE
KSAKTIHNFFAAKQKEGTKNTKDDKKKSSNHSYDPSISNYNPIDNACWKHNEKVPYIALT
RTLELIEDTSARLKIIEILSNYFRSVIVLSSDDLLPSIYLCLNQLAPAYEGIELGVAETN
LMKAIAQCTGRTLAQIKTDVQEVGDLGIVAEGSRSNQRTMFQPAPLTVSSVYTRLKEIAQ
MTGSASVTKKLDKIQSLFVACRFTEARYLIRSLAGKLRIGLAEQSVLQALALACTMTPPK
PTFPPEILDVSKKMSNDTFKQKYDETALILKTTYCECPNYGKIIPVLLKEGIKELPNKCK
ITPGIPMKPMLAHPTKGVQEVLTRFDGLKFTCEWKYDGERAQIHLAEDGKISIYSRNQEN
NTSKYPDIIGRFKNTQGENVKSCILDCEAVAWDNDKKQILPFQILSTRKRKDANESDIKV
QVCVFMFDLLYLNGEPLVQQPFIKRRELLKENFKEVIGEWKFATSLDTSTMEQVQDFLDE
SVKGNCEGLMVKTLEEEATYEIAKRSRNWLKLKKDYLDGISDTLDVVVIGGYIGKGKRTG
TYGGFLLACYDQENEEYQSICKIGTGFSEEDLQKHTEFFKEYIISQTKSYYRYDSSLEPD
HWFEPIQVWEIKCADLSLSPVHKAAIGIVDPEKGISLRFPRFVRIRDDKNSDDATSAQQV
ASMYNNQEQIKNQSSTKITEEDFY

BLAST