GenomeNet

>ame:550667 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) SdhA; succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial (A)
MSGLLKLSSLLVRNPPTTTLNKLGLPVITNRKLHYTPDGKAAKISDGVSKHYPLVDHTYD
AVVVGAGGAGLRAAYGLVAEGFKTAVVTKLFPTRSHTVAAQGGINAALGNMEEDNWQWHM
YDTVKGSDWLGDQDAIHYMTREAPKAVIELENCGMPFSRTSDGKIYQRAFGGQSLKFGKG
GQAHRCCCVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLLMEDGECRGVIALCLEDGT
LHRFHSKNTVLATGGYGRAYFSCTSAHTCTGDGTAMISRANLPNQDLEFVQFHPTGIYGA
GCLITEGSRGEGGYLVNSEGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGVGPEKDH
IYLQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVIPTVHYNMGGIPTNYKGQVLT
RKNDQDTVVPGLYACGESACASVHGANRLGANSLLDLVVFGRACAKTIAAENKPGETIGP
LKPNAGEESVANLDWVRNANGNVSTAELRLSMQKTMQTHAAVFRTAETLQEGCQKMSALY
KKLNDLKVLDKSMIWNSDLIESLELQNLMINAMQTIVAAENRKESRGAHAREDFKDRIDE
YDYSKSTENQKPRPLDQHWRKHTLTKINVRSGEVSIDFRPVIDNTLNKQECATVPPAIRS
Y

BLAST