GenomeNet

>amh:I633_03930 Ubiquinol-cytochrome C reductase iron-sulfur subunit; K00411 ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2] (A)
MSNVSVDATESAHNENQPENNTRRRFLTVATSVVGGVGVVGAAVPFIASWNPSAKAKAAG
ADVEVDISGIEPGQLVRVMWRSKPVWIVRRTPEILEELGTHEDKLKDPNSEAEQQPTFAQ
NRFRSMKEEYLILVGICTHLGCSPQHLKDGAFEEVVEGVPDGFFCPCHGSKFDMAGRVFQ
NVPAPLNLVVPPYQFVDDNTVIIGSEAEVA

BLAST