GenomeNet

>amh:I633_03930 K00411 ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:1.10.2.2] | (GenBank) Ubiquinol-cytochrome C reductase iron-sulfur subunit (A)
MSNVSVDATESAHNENQPENNTRRRFLTVATSVVGGVGVVGAAVPFIASWNPSAKAKAAG
ADVEVDISGIEPGQLVRVMWRSKPVWIVRRTPEILEELGTHEDKLKDPNSEAEQQPTFAQ
NRFRSMKEEYLILVGICTHLGCSPQHLKDGAFEEVVEGVPDGFFCPCHGSKFDMAGRVFQ
NVPAPLNLVVPPYQFVDDNTVIIGSEAEVA

BLAST