GenomeNet

>ami:Amir_1130 alpha amylase catalytic subunit; K01176 alpha-amylase [EC:3.2.1.1] (A)
MAPPARKIALFAAGALIAGVVAAGATQLASTPPTATATPPGAKTVTATLFQWTFDRVATE
CATTLGPKGYGYVEVSPATEHIQGGTWWTSYQPVSYRIAGRLGSEAQFRNMVSACHNAGV
KVIADAVINHMSAGSGTGTGGTRYTKYAYPGHYGDQDFHTCRTDINDYRNRDNVQNCELS
GLSDLNTGSEYVRSEIAEYLNNLLSMGVDGFRIDAAKHMPAADLSAIKAKLTKRDAFWVH
EVIYGAGEAVQPGEYTGSGDVDEFRYAYDLKRVFTSENLAYLKNFGEGWGHLPSGQARPF
VDNWDTERNGSTLSYKDGSNYTLANVFMLAWPYGSPQVYSGYEFSNKDQGPPAPGECYSS
GWECQHRWPQIANMVGFRNTTSGTAVTNWWDNGRNAIAFGRGDKGYAVVNRESSAVSRTF
QTSLPAGTYCDVQRDGCTATHVVNSAGQFTATVNANEAIALHVGAMGNGSNPGAGAAAFS
VNATTVMGQNIFVVGDHASLGGWDPARAVALSSASYPLWKTSVSLPNGTAFAYKYIRKEA
NGSVTWESGANRTSTSPATLNDTWRN

BLAST