GenomeNet

>ami:Amir_1571 DNA polymerase LigD, polymerase domain-containing protein (A)
MAQALELTVGERVVRVSNPDKVYFPERGITKRQVVEYYLAVAEPLLAVLRDRPTTLKRFV
DGVAGEAFYQKRVPKGAPEWVRTVGVRFPSGRPAEQVRPTEAAVLAWAANLGTLDFHPWP
VRAGDTDHPDELRVDLDPQPGTGFREAVEVAGVLREVLGELGMTGYPKTSGGRGVHVAVR
IRPEWDFVDVRHAVIALGREVERRAPDLATTSWWKEERGRKVFLDFNQAARDRTIASAWS
VRGTPGATVSTPVTWESLGEADPVAFDVRTVPDYLRDVGDPHAGLDGEAFGIEELLGWYA
NDPRGELPYPPDYPKMPGEPPRVQPSRKRG

BLAST