GenomeNet

>aml:100466767 NFKBIB; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, beta; K02581 NF-kappa-B inhibitor beta (A)
MAGVACLGKASEADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDT
ALHLAVIHQHEPFLDFLLGFAAGTEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGL
HVAERGGHTALHLACRMRAHACARVLLQPRPRCARGAPNTYLAQGPDRTSAADHPPVALY
PEADSEKEDEESEEHWKLQLEAENYEGHTPLHVAVIHKDAEMVRLLREAGADLNKPEPTC
GRSPXADVLELLLRAGADPAARMYGGRTPLGSATLRPNPILARLLRAHGAPEPEDEDDRP
GPCSSSSDSDSGDEGDEYDDIVVHSGRSQNRLPPTPASKPLPDDPV

BLAST