GenomeNet

>aml:100468973 K05622 transglutaminase 5 [EC:2.3.2.13] | (RefSeq) EPB42; erythrocyte membrane protein band 4.2 (A)
PFSIIALGIKNCDFQAAKNNEEHHTKAISSRHLIVRRGQPFTIILHFQAPVYAFTSTLKK
VALIAQTGEHPSKANKTQAIFPISCLGDQKWWNAAVEDREDQSWTISVTAPTDAIIGRYS
LLLQVLGKKQLLLGQFTLLFNPWAREDAVFLKKESQRREYVLNQNGLIYLGTANCFHEEP
WDFGQFESSVIDLSLGLLSMDKQVEEWGNPEHVAHILGTLLHALKMKSVLPTPQSAAAQE
GGLLNKRRGSVPILRQWITGQGRPVYESQAWVFAAVACTVLRCLGIPARVITTFASAQGT
GGRLSVDEYYNEEGLQNGEGQRGRIWIFQTSTECWMTRPALPPGYDGWQTLYPRVPSGGG
VLGSCDLVPVKAVKEGTLSLTPGVSELFATVNASCVVWKCREDGALELTNSNTKYVGNNI
STKGVGSNRCEDITQNYKYPEGSLQEKEVLEKVQEERMRHEKDSGIHPPSLKTTEPLYMF
LKAPSSLNLGGNAQFSVSLANPSDQKKAVQLAFGLQAIYYNGILAAELWKKKLSLMLDAN
KGEEIPEELSFFHFEQSPPENSFLRLTVMATATHSEPSLSCFAQEDITICRPHLTIEMPE
TTEQYQLLKASVSLHNFLHDPMKDCVISLFGKGLIYRERRYRLASVWPGNTLYTEFQFTP
TQVGLQRLTVEMDCDMFQNVTNYRDVTVKAPELPA

BLAST