GenomeNet

>aml:100468973 EPB42; erythrocyte membrane protein band 4.2; K05622 transglutaminase 5 [EC:2.3.2.13] (A)
MKVPLSFSLRTDSERQHRATVQDRHFLWSSREVWPAAMGQALGIKNCDFQAAKNNEEHHT
KAISSRHLIVRRGQPFTIILHFQAPVYAFTSTLKKVALIAQTGEHPSKANKTQAIFPISC
LGDQKWWNAAVEDREDQSWTISVTAPTDAIIGRYSLLLQVLGKKQLLLGQFTLLFNPWAR
EDAVFLKKESQRREYVLNQNGLIYLGTANCFHEEPWDFGQFESSVIDLSLGLLSMDKQVE
EWGNPEHVAHILGTLLHALKMKSVLPTPQSAAAQEGGLLNKRRGSVPILRQWITGQGRPV
YESQAWVFAAVACTVLRCLGIPARVITTFASAQGTGGRLSVDEYYNEEGLQNGEGQRGRI
WIFQTSTECWMTRPALPPGYDGWQTLYPRVPSGGGVLGSCDLVPVKAVKEGTLSLTPGVS
ELFATVNASCVVWKCREDGALELTNSNTKYVGNNISTKGVGSNRCEDITQNYKYPEGSLQ
EKEVLEKVQEERMRHEKDSGIHPPSLKTTEPLYMFLKAPSSLNLGGNAQFSVSLANPSDQ
KKAVQLAFGLQAIYYNGILAAELWKKKLSLMLDANKVPGEEIPEELSFFHFEQSPPENSF
LRLTVMATATHSEPSLSCFAQEDITICRPHLTIEMPETTEQYQLLKASVSLHNFLHDPMK
DCVISLFGKGLIYRERRYRLASVWPGNTLYTEFQFTPTQVGLQRLTVEMDCDMFQNVTNY
RDVTVKAPELPA

BLAST