GenomeNet

>aml:100474436 B3GALT4; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4; K00715 ganglioside galactosyltransferase [EC:2.4.1.62] (A)
MPLSLFRRLLLAALLLVIIWTLFGPSGIGEELLSLSLASLRPAPASPGPPLALPRLLIPN
EEACRGPGAPPFLLILVCTAPDNLNQRNAIRASWGGLREARGLRVQTLFLLGEPSLWHPT
REPHGIDLVQEAAVQGDILQAAFRDSYRNLTLKTLSGLNWANKHCSMARYILKTDDDVFV
NVPELVSELIRRGGRWEQWEKGKEPPPREVEVGDEDWEVGSVLRSQPTPLLYLGRVHWRV
HPSRTPGSKHQISEEQWPPTWGPFPPYASGTGYVLSASAVQLILKVASRAPSLPLEDVFV
GVSARRGGLTPTHCVKLAGATHYPLDRCCYGKFLLTSHKLDPWKMQEAWKLVGGSEGERT
APFCSWLQEVLGILRCRVIAWLHS

BLAST