GenomeNet

>aml:100478541 SETD1B; SET domain containing 1B; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MENSHPPPHHHXXXXXXXXPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLA
IDEFYVGPVPPKQVTFAKLNDNIRENFLRDMCKKYGEVEEVEILYNPKTKKHLGIAKVVF
ATVRGAKEAVQHLHSTSVMGNIIHVELDTKGETRMRFYELLVTGRYTPQTLPVGELDAVS
PIVNETLQLSDALKRLKDGSLSAGCGSGSSSVTPTSGGTPFSQDTAYSSCRLDTPNSYGQ
GTPLTPRLGTPFSQDSSYSSRQPTPSYLFSQDPTVTFKARRHESKFTDAYNRRHEHHYVH
NSCAVAAVAGAPAAFRSSMDLPFGAVSSSGGNSGPPFKAQPQDSATFAHTPPPAQATPTP
GVTFKSTFSPYQTPVPPFPPPPEEPATTTTFGARDSGEFRRAPVPPPLPPTEPLTKEKPG
TPPGPPPPDANSMELGGRPTFGWSPEPCDSPGTPTLESSPAGLEKPHDSLDSRIEMLLKE
QRTKLPFLREQDSDTELQMEGSPISSSSSQLSPLAPFGTNSQPGFRGPTPPSSRPSSTGL
EDISPTPLPDSDEDDELDLGLGPRPPPEPGPPDPSGLLGQTTEVALDLAGDRTPTSEKMD
EGQQSSGEDMEISDDEMPSAPITSADSPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGG
QWGGMPMSFQMQTQMLSRLMTGQGACPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLSNS
GPGRGQPWPPLPKFDPSVPPPGYVPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVE
VVAFRAFDEWWDKKERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEG
LGLGIGLRGAIRLPSFKVKRKEPPDTASSGDQKRLRPSTSVDEEDEESERERDRDMADAP
CELTKRDPKGVGVRRRPARPLELDSGGEEDEKESLSVSSSSSASSSSGSSTTSPSSSASD
KEERESTEEEEDGEEEEEEEEDDDEEEEEGPRSQVSSSSTSSMSDKVYDDEDSDDQDESE
NDDEDVALSEASEKEEGDSDGEETVSIATSKAGAGSSSESSESSEFESSSESSSSSSEDE
EELVAREEEEEEEEEEAAADESVVPAVPDEDFEEDVATGAPVMESSVMEEEVDIEAEDEA
PEERTPMLEEPPLPVCVEELASCKEPPEEQDLKQEGARLLSPEPPAGEMEARPPASPERT
PEDDLEVEPPTLLSLPLQPPQPPPQPPRPPSPPPEPETPDPPHPPVPLEPPPEEQPPRTP
GLCGSLAKSQSTETVPATPSGEPPLSGGSSGLSLSSPQVPGSPFSYPSQSPSLSSGGLPR
TPGRDFSFTPTFPEPGGPLLLPVCPLPAGRRDERSGPLASPVLLETGLPLPLPLPLPLPL
ALPVPVLRAQTRAPAQLPPLLPAPLAPCPPPIKRKPGRPRRSPPAVLSLDGPLGHQRGPP
SAGTFCSCQASHRPLSFPAPMTPGPXPPVESTKLPFKELENQWPSEAIPPGPRGRDEVTE
EFMDLAKVRGHWRRPPKKRHEDLVAPASPELSPPQPLFRPRSEFEEMTILYDIWNGGIDE
EDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKKRDDGIREHVTGCARSEG
FYTIDKKDKLRYLNSSRASTDEPPTDTQGMSIPAQPHASTRAGSERRSEQRRLLSSFTGS
CDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIRQVIADMREK
RYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSKQ
HINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN

BLAST