GenomeNet

>aml:100478541 K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] | (RefSeq) SETD1B; SET domain containing 1B (A)
MENSHPPPHHHXXXXXXXXPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLA
IDEFYVGPVPPKQVTFAKLNDNIRENFLRDMCKKYGEVEEVEILYNPKTKKHLGIAKVVF
ATVRGAKEAVQHLHSTSVMGNIIHVELDTKGETRMRFYELLVTGRYTPQTLPVGELDAVS
PIVNETLQLSDALKRLKDGSLSAGCGSGSSSVTPTSGGTPFSQDTAYSSCRLDTPNSYGQ
GTPLTPRLGTPFSQDSSYSSRQPTPSYLFSQDPTVTFKARRHESKFTDAYNRRHEHHYVH
NSCAVAAVAGAPAAFRSSMDLPFGAVSSSGGNSGPPFKAQPQDSATFAHTPPPAQATPTP
GVTFKSTFSPYQTPVPPFPPPPEEPATTTTFGARDSGEFRRAPVPPPLPPTEPLTKEKPG
TPPGPPPPDANSMELGGRPTFGWSPEPCDSPGTPTLESSPAGLEKPHDSLDSRIEMLLKE
QRTKLPFLREQDSDTELQMEGSPISSSSSQLSPLAPFGTNSQPGFRGPTPPSSRPSSTGL
EDISPTPLPDSDEDDELDLGLGPRPPPEPGPPDPSGLLGQTTEVALDLAGDRTPTSEKMD
EGQQSSGEDMEISDDEMPSAPITSADSPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGG
QWGGMPMSFQMQTQMLSRLMTGQGACPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLSNS
GPGRGQPWPPLPKFDPSVPPPGYVPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVE
VVAFRAFDEWWDKKERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEG
LGLGIGLRGAIRLPSFKVKRKEPPDTASSGDQKRLRPSTSVDEEDEESERERDRDMADAP
CELTKRDPKGVGVRRRPARPLELDSGGEEDEKESLSVSSSSSASSSSGSSTTSPSSSASD
KEERESTEEEEDGEEEEEEEEDDDEEEEEGPRSQVSSSSTSSMSDKDDEDSDDQDESEND
DEDVALSEASEKEEGDSDGEETVSIATSKAGAGSSSESSESSEFESSSESSSSSSEDEEE
LVAREEEEEEEEEEAAADESVVPAVPDEDFEEDVATGAPVMESSVMEEEVDIEAEDEAPE
ERTPMLEEPPLPVCVEELASCKEPPEEQDLKQEGARLLSPEPPAGEMEARPPASPERTPE
DDLEVEPPTLLSLPLQPPQPPPXXXXXXXXPPQPPRPPSPPPEPETPDPPHPPVPLEPPP
EEQPPRTPGLCGSLAKSQSTETVPATPSGEPPLSGGSSGLSLSSPQVPGSPFSYPSQSPS
LSSGGLPRTPGRDFSFTPTFPEPGGPLLLPVCPLPAGRRDERSGPLASPVLLETGLPLPL
PLPLPLPLALPVPVLRAQTRAPAQLPPLLPAPLAPCPPPIKRKPGRPRRSPPAVLSLDGP
LXPPAGATLGRDLLLLPGQPQTPVFPSTHDPRAVXPPVESTKLPFKELENQWPSEAIPPG
PRGRDEVTEEFMDLAKVRGHWRRPPKKRHEDLVAPASPELSPPQPLFRPRSEFEEMTILY
DIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKKRDDGIREH
VTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPTDTQGMSIPAQPHASTRAGSERRSEQR
RLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIR
QVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQ
KKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN

BLAST