GenomeNet

>aml:100482700 SETD1A; SET domain containing 1A; K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] (A)
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGVHFSVNDSKYIPVEDL
QDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATEATESRRRSSSDTAAYPAGTTGVGTPGNG
TPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDSFSRRHFSASSAPTTTSTAASTTTAATASSSSSSSSSLSSSSSSSSSSSSSHF
RGTDSNYPAYYESWTRYQRHASYPPRRATREEPPGTSFAENTAERFPPSYTSYLPPEPGR
PADQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEARTSPRPASPARSGSPAPETTNES
VPFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSTTGPGSRDTGSEVPSGSGHGPC
TPPPAPANFEDVAPTGSGEPGATRESPKANGQNQASPCSSGEDMEISDDDRGGSPRPDGP
PPPEYPPPPPPPPHIYDFVNSLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGKGLTA
ASAGPPSGAFGEGFLPFPPPQEAAYSLPYALYTQGQEGRGAYSREAYHLPLPMAAEPLPS
SSVSGEEARLPPREEAEPAEGKALPSAGTVGRVLATLVQEMKSIMQRDLNRKMVENVAFG
AFDQWWESKEEKAKPFQNAAKQQAKEEDKEKTKLKEPGLLSLVDWAKSGGTTGIEAFAFG
SGLRGALRLPSFKVKRKEPSEISEASEEKRPRPSTPAEEDEDDAERDKEAGEPGRPGTKP
AKRDEERSKTQGKHRKSFALDSEGEEASQESSSEKDEEEDEEDEEDEEREEAMDTAKKET
EASDGEDGESDSSSKCSLYADSDGENDSTSDSESSSSSSSSSSSSSSSSSSSSSSSESSS
EEEEEEERPATIPSASPPPRDVPAPPPAPVEEPEPERVAGSPVTPLPEQEKSPARPAGST
EEPPPSMPQPPAEPPAGPXPDERPSSPIPLLPPPKKRRKTVSFSAXXXXXXXAPPQTKSP
GPVSRKVPRAVERTIRNLPLDHASLVKSWPEDVSRGGRSRAGGRGRSTEEEEAEPGTEVD
LAVLADLALTPARRGLAALPPGDDSEATETSDEADRPGPLLSHILLEHNYALAVKPPPST
PAPRPLEPVPAPAALFSSPADEVLEAPEVVVPPPPPPPPTFEPRSEFEQMTILYDIWNSG
LDLEDMGYLRLTYERLLQQTSGADWLNDTHWVHHTITNLSTPKRKRRPQDGPREHQTGSA
RSEGYYPISKKEKDRYLDVCPVSARQLEGADTQGTNRVLSERRSEQRRLLSAIGTSAVMD
SDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQMVADMREKRY
VQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCMQPNCYAKVITIESQKKIVIYSKQP
IGVDEEITYDYKFPLEDNKIPCLCGTESCRGSLN

BLAST