GenomeNet

>aml:100482700 K11422 histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43] | (RefSeq) SETD1A; SET domain containing 1A (A)
MDQEGGGDGQKAPSFQWRNYKLIVDPALDPALRRPSQKVYRYDGVHFSVNDSKYIPVEDL
QDPRCHVRSKNRDFSLPVPKFKLDEFYIGQIPLKEVTFARLNDNVRETFLKDMCRKYGEV
EEVEILLHPRTRKHLGLARVLFTSTRGAKETVKNLHLTSVMGNIIHAQLDIKGQQRMKYY
ELIVNGSYTPQTVPTGGKALSEKFQGSGAATEATESRRRSSSDTAAYPAGTTGVGTPGNG
TPCSQDTSFSSSRQDTPSSFGQFTPQSSQGTPYTSRGSTPYSQDSAYSSSTTSTSFKPRR
SENSYQDSFSRRHFSASSAPTTTSTAASTTTAATASSSSSSSSSLSSSSSSSSSSSSSHF
RGTDSNYPAYYESWTRYQRHASYPPRRATREEPPGTSFAENTAERFPPSYTSYLPPEPGR
PADQDYRPPASEAPPPEPPEPGGGGGGGGPSPEREEARTSPRPASPARSGSPAPETTNES
VPFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEENSTTGPGSRDTGSEVPSGSGHGPC
TPPPAPANFEDVAPTGSGEPGATRESPKANGQNQASPCSSGEDMEISDDDRGGSPPXXXX
XXXXXXXXXPPXRPDGPPPPEYPPPPPPPPHIYDFVNSLELMDRLGAQWGGMPMSFQMQT
QMLTRLHQLRQGKGLTAASAGPPSGAFGEGFLPFPPPQEAAYSLPYALYTQGQEGRGAYS
REAYHLPLPMAAEPLPSSSVSGEEARLPPREEAEPAEGKALPSAGTVGRVLATLVQEMKS
IMQRDLNRKMVENVAFGAFDQWWESKEEKAKPFQNAAKQQAKEEDKEKTKLKEPGLLSLV
DWAKSGGTTGIEAFAFGSGLRGALRLPSFKVKRKEPSEISEASEEKRPRPSTPAEEDEDD
AERDKEAGEPGRPGTKPAKRDEERSKTQGKHRKSFALDSEGEEASQESSSEKDEEEDEED
EEDEEREEAMDTAKKETEASDGEDGESDSSSKCSLYADSDGENDSTSDSESSSSSSSSSS
SSSSSSSSSSSSSESSSEEEEEEERPATIPSASPPPRDVPAPPPAPVEEPEPERVAGSPV
TPLPEQEKSPARPAGSTEEPPPSMPQPPAEPPAGPXPDERPSSPIPLLPPPKKRRKTVSF
SAXXXXXXXAPPQTKSPGPVSRKVPRAVERTIRNLPLDHASLVKSWPEDVSRGGRSRAGG
RGRSTEEEEAEPGTEVDLAVLADLALTPARRGLAALPPGDDSEATETSDEADRPGPLLSH
ILLEHNYALAVKPPPSTPAPRPLEPVPAPAALFSSPADEVLEAPEVVVAEXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPPPPPP
TFEPRSEFEQMTILYDIWNSGLDLEDMGYLRLTYERLLQQTSGADWLNDTHWVHHTITNL
STPKRKRRPQDGPREHQTGSARSEGYYPISKKEKDRYLDVCPVSARQLEGADTQGTNRVL
SERRSEQRRLLSAIGTSAVMDSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEM
VIEYVGQNIRQMVADMREKRYVQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCMQPN
CYAKVITIESQKKIVIYSKQPIGVDEEITYDYKFPLEDNKIPCLCGTESCRGSLN

BLAST