GenomeNet

>amr:AM1_1783 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) rbcS; ribulose bisphosphate carboxylase, small subunit RbcS (A)
MRTLPIERRFETFSYLPPLNDEQIRRQIQYILDQGYIAGIEFNDSPEPTAYYWTMWKLPL
FKNPSVQDVLYEIDECRSEYSDKYVRVVGFDNIRQCQVMSFIVHKPGSNSGYRPY

BLAST