GenomeNet

>amr:AM1_1783 rbcS; ribulose bisphosphate carboxylase, small subunit RbcS; K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] (A)
MRTLPIERRFETFSYLPPLNDEQIRRQIQYILDQGYIAGIEFNDSPEPTAYYWTMWKLPL
FKNPSVQDVLYEIDECRSEYSDKYVRVVGFDNIRQCQVMSFIVHKPGSNSGYRPY

BLAST