GenomeNet

>amr:AM1_2962 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (GenBank) superoxide dismutase Mn/Fe domain protein (A)
MQPAAWSQALTDSPDSNLIAQADEGFTVPPLPYSYFALEKYIDTKTMKIHHDKHHAGYVN
NLNAAIAKHPNLAGKSVEDLLTDLNAVPEDIRTAVRNNGGGHANHTLFWDSMTPNAEGKP
KGKLADAIEESFGSFVAFQSEFKKAGLTRFGSGWAWLVLTKDGKLAVTSTPNQDSPLLDG
NIPLLGNDVWEHAYYLKYQNRRGDYLDAWWNVVNWAEVESRYEKAT

BLAST