GenomeNet

>amr:AM1_2962 superoxide dismutase Mn/Fe domain-containing protein; K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MQPAAWSQALTDSPDSNLIAQADEGFTVPPLPYSYFALEKYIDTKTMKIHHDKHHAGYVN
NLNAAIAKHPNLAGKSVEDLLTDLNAVPEDIRTAVRNNGGGHANHTLFWDSMTPNAEGKP
KGKLADAIEESFGSFVAFQSEFKKAGLTRFGSGWAWLVLTKDGKLAVTSTPNQDSPLLDG
NIPLLGNDVWEHAYYLKYQNRRGDYLDAWWNVVNWAEVESRYEKAT

BLAST