GenomeNet

>ams:AMIS_3580 hypothetical protein; K01971 bifunctional non-homologous end joining protein LigD [EC:6.5.1.1] (A)
MKTPDRFVVTVEGRDLELSNLDKVMYPAAGFTKGEVIDYYTRIAPVMLPHLRDRPATRIR
FPNGVDGMHFFEKNKPGGTPDWVRLETLPVPGSTKSRETIEFVVVDDLPTLVWLANLAAI
ELHTPQWRIGADPDLMVVDLDPGAPAGLRECCAVATLMRDRLAADGIDAYPKTSGKKGMQ
LCCPISGTQDSEVVSAYAKKVADELAAMVPGSITAKMAKAIRPGKIFIDWSQNAAAKTTV
TPYSLRAGEGPTGSAPLTWDEVIAMATGEVEARQFGAGEVLERVEEHGDLMAALSEPGPA
VPVSYRRRS

BLAST