GenomeNet

>ams:AMIS_56960 K00857 thymidine kinase [EC:2.7.1.21] | (GenBank) putative thymidine kinase (A)
MAPVYHELTLFHGSMGAGKSTLALQNAYNRRQAGRPGVLLTSMDRAGSGVLSSRLGVMAD
AIEVTDGADLVTLIEAQVPAGGFVIVDEAQFLRPEQVEQLALAVDELHVDVDCYAISTDF
MSRLFPGSQRLLELADRIVSLQVEVTCWCGRPGRQNARIEDGRVARSGAQVAVGDIDAAA
EVSYRVLCRRHWREGVAGPAQG

BLAST