GenomeNet

>ams:AMIS_67600 hypothetical protein (A)
MAAKATVIEAGDYDVRVSNPDRIYFPELGATKLDLVEYYLAVSDGIVRALRERPCMLHRF
PDGLSGEKVHQKRVPNGAPPWLETVRVKFPRYNRHADELCVTKPADVIWAVQMSTVEFHP
WNSRRADTERPDEWRIDLDPMPDCPFDTVRTVAGVVHEVLDELGITGYPKTSGGKGLHVY
VRIEPRWGFSEVRRAALAFARAVEKRAPDDVTTTWWRKDRDPKSLFIDYNQNARDHTIAS
AYSVRGVPSATVSTPVRWDEIPDVEPRDLTIRTVPARFAELGDLHATIDDQAFSLDTLLE
WADQEGLSTDDDG

BLAST