GenomeNet

>ams:AMIS_67600 no KO assigned | (GenBank) hypothetical protein (A)
MAAKATVIEAGDYDVRVSNPDRIYFPELGATKLDLVEYYLAVSDGIVRALRERPCMLHRF
PDGLSGEKVHQKRVPNGAPPWLETVRVKFPRYNRHADELCVTKPADVIWAVQMSTVEFHP
WNSRRADTERPDEWRIDLDPMPDCPFDTVRTVAGVVHEVLDELGITGYPKTSGGKGLHVY
VRIEPRWGFSEVRRAALAFARAVEKRAPDDVTTTWWRKDRDPKSLFIDYNQNARDHTIAS
AYSVRGVPSATVSTPVRWDEIPDVEPRDLTIRTVPARFAELGDLHATIDDQAFSLDTLLE
WADQEGLSTDDDG

BLAST