GenomeNet

>ang:ANI_1_2706024 K00234 succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1] | (RefSeq) An02g07600; succinate dehydrogenase [ubiquinone] flavoprotein subunit (A)
MYRLSRAFHQRTPLPNPFQTRPFLKRHRPFSTLPRHSSPGPSVSEAPLFDHYYDAIVIGA
GGAGLRAAVGLTESGFRTACITKLFPTRSHTVAAQGGINAALGNMTKDDYRWHMYDTVKG
SDWLGDQDAIHYMTREAPKAIYELENYGMAFSRTEDGRIYQRALGGQSLDYGKGGQAYRT
ACAADRTGHAMLHALYGEALKHDTQFFVEFFALDLLMVDGACVGVICLSLEDGTLHRFFA
RNTVLATGGYGRAYFSCTSAHTSTGDGNAIVARAGLPNQDMEFVQFHPSGIHGAGVLITE
GARGEGGYLLNAHGERFMERYAPTAKDLASRDVVARAMNLEIREGRGCGPDKDHIHLQLS
HLPAELIRSRLPGILETASIFAGIDITRDPIPVVPTVHYCMGGIPTNYKGQVLTSSSHTS
SGTNIPDAEVEPVPGLYAAGECASVSVHGANRLGANSLLDIVVFGRACALHIAETNEPNM
PLHNIPHDDTPPSSLGQDSLSSLSTTLHATGDLPSSSLRHNLQRAMQTDLAVFRTHESLT
TGLSKVIQVQNDFSTRLRTSDRSLIWNSDLVETLELRNLLTCAAQTAMAALCRTESRGSH
AREDFPERDDEGWLKHSWTWQKDEKEEGVRVGYRGVIMKTLDEGDCKSVPPVKRSY

BLAST