GenomeNet

>ani:AN1923.2 hypothetical protein; K00814 alanine transaminase [EC:2.6.1.2] (A)
MTTRTTVPNASQRALSTAAVRCLTLDNINSNVKAAKYAVRGELAVKAEEYRVRLAQGDKT
LPFDSVIFANIGNPQQLDQKPITFFRQVLSLMENPLLLSNKDALRTSFGYQDDVIERAEK
LLAEVQSVGAYSHSQGAPLIRESVAKFIEERDGFPADPQSLYLTGGASSGVNTILNVICN
GPNAGVLVPIPQYPLYTATLSLLNAQCVPYHLEEQKAWGTDIGTIKKSLEQAKAAGTDVR
AIVVINPGNPTGASLSPADIKSVLDIAAEEKLVVIADEVYQTNVFIGEFTSFKKRLRELQ
QEVPGKYDNVELVSLHSTSKGMVGECGHRGGYFELVGFDPLVAAQVYKFISIMLCPPVIG
QCLVELMVNPPKEGEPSHELYQKEYNGIREGLRQRAFALYEAFQRMEGVECQEPQGAMYL
FPTISLPPKAIEAAAAENRAADEFYCLRLLDATGVCVVPGSGFGQKENTLHFRTTFLAPG
TDWVERIVKFHSEFMAKYK

BLAST