GenomeNet

>ani:AN2018.2 K01176 alpha-amylase [EC:3.2.1.1] | (RefSeq) hypothetical protein (A)
MRSPLFLSFAATVLAATPAEWRSQSIYFLLTDRFARTDNSTTAECDTSAKYCGGTWQGII
NQLDYIQGMGFTAIWITPVTANLEDGQHGEAYHGYWQQDIYALNPHFGTQDDLRALSDAL
HDRGMYLMVDVVANHFGYDAPAASVDYSAFNPFNSADYFHTPCDITDYDNQTQVEDCWLY
TDAVSLPDVDTTNEEVKEIWYDWVGDLVSDYSIDGLRIDTARHVQKDFWRDYNDAAGVYC
VGEVFQGDPDYTCGYQEVMDGVLNYPIYYPLLRAFSSTSGSLSDLANMIETVKYTCSDAT
LLGNFIENHDNPRFASYTDDISLAKNVAAFVILSDGIPIIYAGQEQHYSGAGDPANREAT
WLSGYDSTSELYQFISKTNQIRNHAIWQNETYLSYKNYAIYNENNVLAMRKGFDGSQIIT
ILTNAGADAGSSTVSVPNTGFTAGAAVTEIYTCEDITVSGSGEVSVPMESGLPRVLYPKA
KLEGSGICGL

BLAST