GenomeNet

>ani:AN2366.2 K01312 trypsin [EC:3.4.21.4] | (RefSeq) hypothetical protein (A)
MKTAVKTTALLSLLSTAMADKAIVGGDDAEITEYPYQIALLSGGSLICGGSIISSKYVVT
AGHCTDGASASSLSIRAGSTYHDKGGTVVDVEAITVHPEYNANTVDNDISILELAEELQF
GDGIKAIDLPSSSSLPSEGTIGTATGWGALTEGGNVSPNLQYVEVPVVSKSQCSSDYSGF
NEITASMFCAGEEEGGKDGCQGDSGGPFAADGVLIGITSWGNGCARAGYPGVYSSPAYFR
DFIQQVTGL

BLAST