GenomeNet

>ani:AN4255.2 K00844 hexokinase [EC:2.7.1.1] | (RefSeq) hypothetical protein (A)
MSSPLVKVLHRMQALFSNIVAALETMLLFPSLFRDSSRGGGKSRAAFRRRRALDALADEI
EIIFSKPLTLKNMLAMSEKIREQFRAGLESSPINMLPSYNHALPTGLEQGTFLALDVGGS
TMRVALIELCGQGKMEVLRVSSSLIDNDVKLLEGTSFFDWMAEKIEEMLREVGTNYGREE
APLSMGLSWSFPIEQTSISSGLVIHMGKGFRCSMGTVGQELGSLIVQSCQKRGLNVRVDA
IVNDSSAALLSRAYVDPTTRMSLILGTGTNVAIHFPVHAIGLGKFGKRPQGWFDYAKHVI
INSEMSMFGGGVLPMTRWDDILNRTHLRPDYQPLEYMATGRYLGEIVRLIIVDAVETAQL
FGGELPHSMRDAYSLDTSIVAFIEADTSPFLTASAALLQKEHTMSRPPSPEDLRFLLRVC
RTISKRAAGYLATAIHSMWCLRNEAEISQGPPSPSFKGPRDVTVTESGSNSDCLSIACDG
SVINKYPGFRDRCQAYLDQLTQETNTSKVSQISEEGSCIRLEPAPEGAIFGAAVAVAVAV
AGKLEQTIV

BLAST