GenomeNet

>ani:AN5499.2 hypothetical protein; K09291 nucleoprotein TPR (A)
MNPAAELPELGMNQPQLHRDNPGSNMAAATIEIPFLSSHYAIAESTLSTLTEAPTVELVN
QLLEAITKKARETDELKSDKLRLEVELENAVRSSETKIKVLKGSVEKGHAEVEETRKKLH
ESETVRSSLESEIAALKSSSTSNDSELSSLKSRITSLEASNRDTLALLESKSAAYDKLAE
ELSTQHKKTIELRRELSTAEQNLQAANSASASAKLREQSLQNELELTKKNNEWFETELKT
KSAEYLKFRKEKSARIAELQRENEEAIATTESLRRSENALKSRLDEVEQRYEESLSSIQQ
LKEEAIQAAESFRIELDSANRLAELQENAAKTAKNRVQECQLALEKVRDDAAEEISRLRV
EIETEHSDKEAAERRVAELELTINQLETEGAAGRRSMSPARGLNGAPGTPVRPSTPLGTF
SPRTSRSKGSLTLTQMYTEYDKMRTMLAAEQKTNQELRSTLDEMVQDLEASKPEIDELRE
DHARLENAVVEMSNILDTAGKERDEATKESRKWQGQVEGLAREGDILRQQLRDLSSQIKV
LVLEVTLLKEGEANYDREELEKVARREIEDSSADLTPTGRFISQNLTTFKDLHELQEQNV
TLRRMLRELGDKMEGAEARERDVTRQQEQEELKELRIRVQTYRDEIANLIAQTKSYVKER
DTFRSMLTRRRQTVGGDAVFSQSLPLGAAPPASENSTGVPDYAELLRKVQAHFDSFREET
ATDHAALKQQVNELSRKNSELMSEASRSNSQLVAATQRAELLQSNFNMLKTENAELQKRY
AALFETANRQDLRTQQAAEDLVESKGLIDSLQRESANLKAEKTLWKNIEKRLIEDNETLR
NERSRLDSLNANLQNILNEREHADSESRRRLQQSVESLESELQTTKRELNEQIEESKKAT
LRREYEHEQNQKRIDDLVTSLSSTKEELVAVKTTRDHLQSRVDELTVELRSAEERLQVLQ
SRPSVSGAPAETAPPEGSQESGLTREQELSIEVSELKRDLELARTDLEHAKEQVEDYKAI
SQATEERLQSVSDTNDQYREETEQLVKEKDARIQDLEKRIEEISSELSATNTELSKLRDG
QSEVARRLEEQKASLEADIARLTEENERQIAAAQYHQEDLKAQAEIAQHAQQNYESELVK
HAEAAKNLQTVRAEANQLKLEVVELRTQAETFKKDLAQKEESWNERKDRYESELLELQKR
RDEVLHQNNLLHSQIENITKQISALQRDRATIAETEQDNGEAVAPNLEGLQEVISFLRRE
KEIVDVQYHLSTQEAKRLRQQLDHAQSQLDEARLKLEQERRAQTDSESADLSHNKLMNTL
NELNIFRESSVTLRSQLQQTKTALAEKSARVDELVQQIAPLETQIRQLEDAVETKDEEMK
LLQQDRDHWQQRTQNILQKYDRVDPAQMEELKQELEKLRTERDEAISAREALEKQVEAFP
EQLSAAEQRTQDLRSKLTEQFKARSRELMGRVNAKQTELDAVVQEREVLQEELKTTKEEL
EALKSKLAEKPEAPADQGTVVDSTPASQFPIPTTQAPAPTDDERVKALEEKVQRLEAALA
EKESVLAAKDAEHETKVKERVERLKEVFNNKMAEVRANHRQEIERLTATQGGAHEGAEGA
QETPGTPQPKQQPPATPSKSEDGLPDLTDAQARQLVARNETIRTILRNNIKQQLAKEREK
QGQETQSTQDAIAAAEQKFNDEREALRKAHEEGMEEKIKSAVELSDKKYLARISMLDSRY
RNTQAKVDIVSKAATETPQKPVVEVWEIAKVAKAPPAQAQTPKPSPATPAQVASPAPQVA
QPAPTPAQTGAASQQSAPAQPPTQAPAQAPAQAPTQAPTQAPAQASAPEAAPGAAAAAPA
QPQPSEQPSQTQQPQSEEGSSAAPPPATATSGVPNPFGQTQNKQQPQPQPQGSNLPNKPP
AGGVLRTLQSGLPVARGGRGGARGGSHQQNPFGQLAQQAQSQAPQQQQQSQRGGGIARGR
GGRGGQGRGAHQNTQAQGQAQGQAQGQAQAQAQPSAGRGGLNAGARQFVPQGNKRAREDG
TDNANEGGNAGGKRMRGGGHTRGS

BLAST