GenomeNet

>ani:AN6388.2 hypothetical protein; K01190 beta-galactosidase [EC:3.2.1.23] (A)
MKLQSCAYLGWGLALAASSAVALSVRNTNKAPSQSVRERASLNHQWKFWHSEQIPDNIVY
DLRPDANDSSFQVLKSWVLPVGNDYIKNANAQHERPSTEPDGDIPYVHNDFDDSSWDVVR
LPHDWAITRPFYTDDDPEIPSAMGRLPVQGVGWYRRKLNFTQEDSDKVVLLEIDGAMSYP
MVWLNGHLVGGWPYGYNSFQLDLTPYLQQGEENQLAIRVENPSGSSSRWYPGGGIYRNVW
LTKVNPTHVAHYGTKMTTRDVSSRRATIDFQVQIENKGQKRQRVEVATEIFDLDSANGHV
RGRKVEQFPRHKVIVDKDNPRLWGPPPDQTPNLYIAVTSLYDASGHLLDTYSTEFGVRSV
EYNPNTGLSVNGAPVRIQGVNQHHDLGALGAAFNRRAAQRQLELLCDLGVNAIRTAHNPP
APELLEMTDRMGFLVLDEIFDSWAQQKTDLDFHLIFNDWREPDLRSFLRRDRNHPSVIIW
SIGNEVAEQSADDTAAAIATYLRDIVREEDNTRPVTASMNSAWPNSSFAGVVDLISLNYQ
GEGLRYGPAYSHLEGNRRDPQYSEFHVTHPDKLILGSEVAWSLSTRGTFLFPVTNYTSAP
VNDTSGGNSTTLEISAYELYSSDPGSSPDRVFATQDEHPFVDGGFVWAGWDYLGEPYPYY
DGARSAYSGIIDLAGFKKERFYLYQARWQPDVRMAHIVPHWSWPERVGQVTPVHVFTSGD
EAELFVNGVSQGRLKRDPLTYRFRWDEVVYEPGEVQVVAYKNGSKWATDTVKTAGEPTQL
RLTPDRAQIAADGEDLSFVTLEVLDGKGNVVPEAKNLIHFEVSGPGEIVATDNGFPADYT
AFPSHERTAFHGLALCIVKGELGTHGDIVLKASSNGVGEAEVVIKASRGMP

BLAST