GenomeNet

>aol:S58_58780 K01602 ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39] | (GenBank) ribulose bisphosphate carboxylase small chain, RuBisCO small subunit (A)
MRVTQGCFSFLPDLTDDQITAQIQYCLEKGWAVNIEFTDDPHPRNTYWEMWGLPMFDLRD
AAGIMRELSECRKIYGDRYIRISAFDSSHGWESIRLSFIVNRPQNEPGFRLDRQETVGRN
QRYSTRSYAAERPEGERYS

BLAST