GenomeNet

>aol:S58_58790 ribulose bisphosphate carboxylase large chain, RuBisCO large subunit; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MNDQSITVRGKDRYKSGVMEYKKMGYWEPSYQPKDTDVIALFRVTPQDGVDPTEACAAVA
GESSTATWTVVWTDRLTAAEKYRAKCYRVEPVPGSPGSYFAYIAYDLDLFEPGSISNLTA
SIIGNVFGFKPLKALRLEDMRLPVAYVKTFQGPATGIVVERERLDKFGRPLLGATVKPKL
GLSGRNYGRVVYEALKGGLDFTKDDENINSQPFMHWRERFLYCMEAVNKAQAASGEIKGT
YLNVTAGTMEDMYERAEFAKELGSNIVMIDLVIGYTAIQSMAKWARRNDMILHLHRAGHS
TYTRQRSHGVSFRVIAKWMRLAGVDHIHAGTVVGKLEGDPNTTRGYYDICREDFNPMRLE
HGVFFDQNWASLNKLMPVASGGIHAGQMHQLLDLLGEDVVLQFGGGTIGHPRGIAAGATA
NRVALEAMILARNEGRDYVHEGPEILAKAAQTCTPLREALEIWKDVTFNYESTDSPDFVP
TVTPAA

BLAST