GenomeNet

>aol:S58_67690 K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] | (GenBank) uncharacterized ribulose bisphosphate carboxylase-like protein (A)
MVASDHFEASYLIETPLDPLDVAEVMAGEQSCGTFTRVEGETDALRARARASVTGVVELP
AVDQPSLPNAWLRRKGATGPYRRARVTISFPVANVGANLPTLASVVAGNLYDLGEVTGLR
LEQITLPAAYRARFDSPKQGIAGTRRLTGVRSGALVGSIIKPNVGLDADETAALVARLCA
AGVDFIKDDEISADPDHAPLAKRIPAVMAAIRRHRDSTGKHVMMAFNITDETDAMRRHAD
LIAQHGGSCAMVSLNWCGFSAVTTLRRSSDLALHGHRNGFGAISRHPLLGIGFQPYQTLW
RLAGVDHMHVHGLQGKFAQEDDEVVESARDCVTPLTEGCDDRVLPAFSSGQSAATVQATY
DAIGHADLLFMAGGGIMAHPGGPAAGVSSIRQAWDAVTSGVSLEQAAGVHPELRQALASF
GRTG

BLAST