GenomeNet

>aol:S58_67690 uncharacterized ribulose bisphosphate carboxylase-like protein; K01601 ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39] (A)
MVASDHFEASYLIETPLDPLDVAEVMAGEQSCGTFTRVEGETDALRARARASVTGVVELP
AVDQPSLPNAWLRRKGATGPYRRARVTISFPVANVGANLPTLASVVAGNLYDLGEVTGLR
LEQITLPAAYRARFDSPKQGIAGTRRLTGVRSGALVGSIIKPNVGLDADETAALVARLCA
AGVDFIKDDEISADPDHAPLAKRIPAVMAAIRRHRDSTGKHVMMAFNITDETDAMRRHAD
LIAQHGGSCAMVSLNWCGFSAVTTLRRSSDLALHGHRNGFGAISRHPLLGIGFQPYQTLW
RLAGVDHMHVHGLQGKFAQEDDEVVESARDCVTPLTEGCDDRVLPAFSSGQSAATVQATY
DAIGHADLLFMAGGGIMAHPGGPAAGVSSIRQAWDAVTSGVSLEQAAGVHPELRQALASF
GRTG

BLAST