GenomeNet

>apb:SAR116_0754 K00128 aldehyde dehydrogenase (NAD+) [EC:1.2.1.3] | (GenBank) aldehyde dehydrogenase family protein (A)
MIDKTDLYIDGEWVKSIDGRVVPVINPATEEEYASITLAGKADTESAIAAAKRAFPAWSM
TSPEERLDYLKKLLEVYQAREREMAHTISDEMGAPIDLAISEQASSGSSHLKAFIRTLAA
FEWVRPLRPGTAGQDLTYEPAGVAALITPWNWPMNQVVLKVGAAIAAGCTMVLKPSEIAP
MSGMLFAEMVHEVGLPAGVFNLINGDGVGAGSIMSSHPDIDVVSFTGSTRAGILITKAAA
DSVKNVSLELGGKSPNLIFDDCDIEAAVTRGTKFCFNNTGQSCNAATRMLVERSAYDQAV
EVAARVADETKVDMPSKEGKHIGPLVSEAQFNKVQDLIQKGIDEGARLVAGGVGRPDGLN
RGYFVRPTVFADTNNDMTIMREEIFGPVLSIMPFDTEDEAIAIANDTPFGLSAYLQTGDT
ERAHRVARQLRAGMVQVNGASRASGSPFGGFKQSGVGREGGAMGIEEFLEVKTISGIVDA

BLAST