GenomeNet

>apb:SAR116_1612 Thymidine kinase (EC:2.7.1.21); K00857 thymidine kinase [EC:2.7.1.21] (A)
MAKLYFSYSAMNAGKSTILLQASHNYKERGMNTVLLTARLDDRIGQGEDGKGKIGSRIGL
QADAEMFDDSTDIFALATELSRDSDIACIMVDEAQFLTIAQVWQLSAIADELGIPVMCYG
LRTDFQGQLFDGSATLLAIADVLREIRTICHCGRKATMVVRQDADGKPITDGAQIEIGGN
DKYVSLCRRHWKAAMAKVAESD

BLAST