GenomeNet

>apc:HIMB59_00002850 K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] | (GenBank) iron/manganese superoxide dismutase family protein (A)
MSFELPSLPYANDALAPYMSAETLDFHHGKHHQTYVTNLNNLLKDNELQGASLEDIVVKS
SKDTSMAGIFNNAGQHWNHILFWQCMKPNGGGSIPSELEARLNSDFGSVDQFKEAFIQAG
TTQFGSGWAWLAIDNGKLVVTKSANASNPLVDGMKPILGCDVWEHSYYIDYRNKRPDYLK
AFLDSLVNWEFVASQLD

BLAST