GenomeNet

>apc:HIMB59_00002850 iron/manganese superoxide dismutase family protein (EC:1.15.1.1); K04564 superoxide dismutase, Fe-Mn family [EC:1.15.1.1] (A)
MSFELPSLPYANDALAPYMSAETLDFHHGKHHQTYVTNLNNLLKDNELQGASLEDIVVKS
SKDTSMAGIFNNAGQHWNHILFWQCMKPNGGGSIPSELEARLNSDFGSVDQFKEAFIQAG
TTQFGSGWAWLAIDNGKLVVTKSANASNPLVDGMKPILGCDVWEHSYYIDYRNKRPDYLK
AFLDSLVNWEFVASQLD

BLAST