GenomeNet

>ape:APE_0412 hypothetical protein; K18933 tyrosine decarboxylase / aspartate 1-decarboxylase [EC:4.1.1.25 4.1.1.11] (A)
MAIILGGMVPRPPWKYRLLAAIHAHRNAGDPGADPLVRRAVERLVAVTSRVVFGVEKPGW
ITSGASEGNLLALYTLREEGYRRVVAFDTSHYSIKKSALTLSMELDLLPTHGGRPRLDLL
ERRITPDSVVVATVGTTQEGLVDPVEEIAGVAESVGAAVHVDAAYGGYIARFLTGKARFR
LEPPVMTVVVDAHKIPEAPPPAGVILASKQKLLDNLWFESPYIPTGRQFGILGTRPGGPI
VAAWRRVEDLERNPGFPRLASILMRRLRKTLKALERLGYETPVTPDLPVACATHPRLGEV
LERLKASGVRVYRCRSPKPCLHVTNYGRLCRARLGSSRSPRGCLRKPLGASLGNPGVTGL
GL

BLAST