GenomeNet

>api:100163276 stress-activated protein kinase JNK-like; K04440 c-Jun N-terminal kinase [EC:2.7.11.24] (A)
MPHINPRMTSRVSSSIFFTVEVGDTKFTILKRYQNLKPIGSGAQGIVCAAMDTITQQSVA
IKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRTLDDFQDVYLVMELMDA
NLCQVIQMDLDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLA
RTAGTTFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIRGGVLFPGTDHIDQ
WNKIIEQLGTPSQEFMRRLQPTVRNYVENRPRYPGYSFDRLFPDVLFPSDSSEHNKLKAS
QARDLLSRMLVIDPEKRISVDDALLHPYINVWYDESEVNAPAPGPWDHSVDEREHTVDQW
KELIYQEVMEYDPTTAAAASANEPQPIR

BLAST