GenomeNet

>api:100163276 K04440 c-Jun N-terminal kinase [EC:2.7.11.24] | (RefSeq) stress-activated protein kinase JNK (A)
MPHINPRMTSRVSSSIFFTVEVGDTKFTILKRYQNLKPIGSGAQGIVCAAMDTITQQSVA
IKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRTLDDFQDVYLVMELMDA
NLCQVIQMDLDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLA
RTAGTTFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIRGGVLFPGTDHIDQ
WNKIIEQLGTPSQEFMRRLQPTVRNYVENRPRYPGYSFDRLFPDVLFPSDSSEHNKLKAS
QARDLLSRMLVIDPEKRISVDDALLHPYINVWYDESEVNAPAPGPWDHSVDEREHTVDQW
KELIYQEVMEYDPTTAAAASANEPQPIR

BLAST